- Recombinant Drosophila sechellia Vacuolar ATPase assembly integral membrane protein VMA21 (GM22297)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1106747
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,354 Da
- E Coli or Yeast
- 1-105
- GM22297, dsec_GLEANR_5081
- Vacuolar ATPase assembly integral membrane protein VMA21 (GM22297)
Sequence
MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQFLNISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD